OR4L1 Peptide - C-terminal region
OR4L1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR14-28, OR4L2P
UniProt
Q8NH43
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4L1 Rabbit Polyclonal Antibody (orb587603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004717
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CIFIYVWPFSSLASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRKLRF
More Discoveries
Explore Other Products
Browse additional items from our catalog
46476121 3x 1.0µg DNA
TECTB CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
K4090107 1.0 µg DNA
Rnf139 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 