OR4N2 Peptide - C-terminal region
OR4N2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR14-13, OR14-8
UniProt
Q8NGD1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4N2 Rabbit Polyclonal Antibody (orb587605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004723
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKKVFNKHIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cytochrome P450 Reductase Recombinant Rabbit Monoclonal Antibody [JB54-31]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81061/imageurl/et7107-35.webp)
ET7107-35 100 µL
Cytochrome P450 Reductase Recombinant Rabbit Monoclonal Antibody [JB54-31]
Sign In for Pricing
View Details 
TP305725 20 µg
Eph receptor A2 (EPHA2) (NM_004431) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC401819-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942344-500 1x 500 µL
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details