Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4N2 Peptide - C-terminal region

OR4N2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR14-13, OR14-8

UniProt

Q8NGD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4N2 Rabbit Polyclonal Antibody (orb587605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004723

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKKVFNKHIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE-1 Antibody
8C0254-AAT 50 µg

MAGE-1 Antibody

Sign In for Pricing
View Details
Tas2r134 Mouse Gene Knockout Kit (CRISPR)
KN517215 1 Kit

Tas2r134 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ndp (NM_010883) Mouse Tagged ORF Clone
MG200756 10 µg

Ndp (NM_010883) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cardiac Troponin I Antibody
KC-199-01 50 μL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details
Cardiac Troponin I Antibody
KC-199-02 100 µL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details
Cardiac Troponin I Antibody
KC-199-03 1 mL

Cardiac Troponin I Antibody

Sign In for Pricing
View Details