WT1 Peptide - N-terminal region
WT1 Peptide - N-terminal region
Product Specifications
UniProt
P19544
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WT1 Rabbit Polyclonal Antibody (orb329588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC427102 20 µg
SLC9A3R2 (NM_001130012) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-O235995-50MG 50 mg
(2S,3aR,7aS)-Octahydroindole-2-carboxylic Acid (~90%, contains cis)
Sign In for Pricing
View Details 