ISL1 Peptide - C-terminal region
ISL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ISLET1, Isl-1
UniProt
P61371
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ISL1 Rabbit Polyclonal Antibody (orb573759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002193
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
I8443-18H-01 25 µg
Interleukin 22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF) (Biotin) discontinued
Sign In for Pricing
View Details I8443-18H-02 50 µg
Interleukin 22 (IL-22, IL-10 Related T cell-derived Inducible Factor, IL-TIF) (Biotin) discontinued
Sign In for Pricing
View Details GTR15188290 1 Vial
Lentiviral mouse Cnot3 shRNA (UAS) - Lentiviral mouse Cnot3 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details