ISL1 Peptide - C-terminal region
ISL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ISLET1, Isl-1
UniProt
P61371
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ISL1 Rabbit Polyclonal Antibody (orb573759) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002193
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7207534-01 48 Well
Goat Cytochrome c oxidase assembly protein COX19 (COX19) ELISA Kit
Sign In for Pricing
View Details MBS7207534-02 96 Well
Goat Cytochrome c oxidase assembly protein COX19 (COX19) ELISA Kit
Sign In for Pricing
View Details MBS7207534-03 5x 96 Well
Goat Cytochrome c oxidase assembly protein COX19 (COX19) ELISA Kit
Sign In for Pricing
View Details MBS7207534-04 10x 96 Well
Goat Cytochrome c oxidase assembly protein COX19 (COX19) ELISA Kit
Sign In for Pricing
View Details 
251688-APC 100 µL
SIX4 (SIX Homeobox 4, AREC3, MGC119450, MGC119452, MGC119453) (APC)
Sign In for Pricing
View Details 