Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1B Peptide - N-terminal region

STEAP1B Peptide - N-terminal region

Product Specifications

UniProt

C9JE84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STEAP1B Rabbit Polyclonal Antibody (orb324659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal B220/CD45R Antibody (PTPRC/1460) [HRP]
NBP2-54465H 100 µL

Mouse Monoclonal B220/CD45R Antibody (PTPRC/1460) [HRP]

Sign In for Pricing
View Details
Rabbit anti-Diaphanous 2 Antibody, Affinity Purified
A300-079A 100 µg

Rabbit anti-Diaphanous 2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Alpl Rat siRNA Oligo Duplex (Locus ID 25586)
SR504011 1 Kit

Alpl Rat siRNA Oligo Duplex (Locus ID 25586)

Sign In for Pricing
View Details
ALKBH2 antibody - middle region
MBS3210429-01 0.1 mL

ALKBH2 antibody - middle region

Sign In for Pricing
View Details
ALKBH2 antibody - middle region
MBS3210429-02 5x 0.1 mL

ALKBH2 antibody - middle region

Sign In for Pricing
View Details
OR1F1 ORF Vector (Human) (pORF)
ORF026568 1.0 µg DNA

OR1F1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details