Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STEAP1B Peptide - N-terminal region

STEAP1B Peptide - N-terminal region

Product Specifications

UniProt

C9JE84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STEAP1B Rabbit Polyclonal Antibody (orb324659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPT Antibody
CSB-PA009864GA01HU 100 µL

GPT Antibody

Sign In for Pricing
View Details
Chicken Galectin 3 ELISA Kit
MBS743634-01 48 Well

Chicken Galectin 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin 3 ELISA Kit
MBS743634-02 96 Well

Chicken Galectin 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin 3 ELISA Kit
MBS743634-03 5x 96 Well

Chicken Galectin 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Galectin 3 ELISA Kit
MBS743634-04 10x 96 Well

Chicken Galectin 3 ELISA Kit

Sign In for Pricing
View Details
Anti-Phospho-Nrf2 (S40) NFE2L2 Rabbit Monoclonal Antibody, Carrier-free
P00078-carrier-free 100 µL

Anti-Phospho-Nrf2 (S40) NFE2L2 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details