ZNF681 Peptide - middle region
ZNF681 Peptide - middle region
Product Specifications
UniProt
Q96N22
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF681 Rabbit Polyclonal Antibody (orb577024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612143
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FAQDFSPEQNIKDSFQKVTPRRYGKCEHENLQLSKSVDECKVQKGGYNGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-KIT6815-1X1ML 1 mL
6-Alpha-Oxycodol-d3 (1.0mg/ml in Acetonitrile)
Sign In for Pricing
View Details 
LY400010 100 µg
Apolipoprotein CIII (APOC3) (NM_000040) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNUM1782-50 1x 50 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), 1mg/mL
Sign In for Pricing
View Details