ZNF681 Peptide - middle region
ZNF681 Peptide - middle region
Product Specifications
UniProt
Q96N22
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF681 Rabbit Polyclonal Antibody (orb577024) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612143
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FAQDFSPEQNIKDSFQKVTPRRYGKCEHENLQLSKSVDECKVQKGGYNGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400043-100 1x 100 µL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682986-100 1x 100 µL
BRCA1 (Breast Marker) (BRCA1/2986), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![[6]-Shogaol](https://cdn.genprice.uk/products/572/4416072539935/imageurl/trc-s357800-50mg.webp)
