Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF772 Peptide - N-terminal region

ZNF772 Peptide - N-terminal region

Product Specifications

UniProt

Q68DY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF772 Rabbit Polyclonal Antibody (orb577364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Pax2 Antibody (CL9469)
NBP2-88934 100 µL

Mouse Monoclonal Pax2 Antibody (CL9469)

Sign In for Pricing
View Details
Ndufb8 (NM_026061) Mouse Tagged Lenti ORF Clone
MR201748L3 10 µg

Ndufb8 (NM_026061) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AARDGAS250X26CARD-T1-P2 Pipe Markers for Gases
N004037 4 Card (4 Marker (s) x 1 Card)

AARDGAS250X26CARD-T1-P2 Pipe Markers for Gases

Sign In for Pricing
View Details
SOX2 (Transcript ion Factor SOX-2, MGC2413) (HRP)
133719-HRP 100 µL

SOX2 (Transcript ion Factor SOX-2, MGC2413) (HRP)

Sign In for Pricing
View Details
2-Bromo-1- (chloromethyl) -4- (ethylsulfanyl) benzene
UGD74515-01 100 mg

2-Bromo-1- (chloromethyl) -4- (ethylsulfanyl) benzene

Sign In for Pricing
View Details
2-Bromo-1- (chloromethyl) -4- (ethylsulfanyl) benzene
UGD74515-02 1 g

2-Bromo-1- (chloromethyl) -4- (ethylsulfanyl) benzene

Sign In for Pricing
View Details