Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF772 Peptide - N-terminal region

ZNF772 Peptide - N-terminal region

Product Specifications

UniProt

Q68DY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF772 Rabbit Polyclonal Antibody (orb577364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD74 Antibody (LN-2) [Alexa Fluor 532]
NBP2-33088AF532 0.1 mL

Mouse Monoclonal CD74 Antibody (LN-2) [Alexa Fluor 532]

Sign In for Pricing
View Details
YANK2 Lentiviral Activation Particles (m)
sc-425690-LAC 200 µL

YANK2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rabbit Anti-NDRG1 antibody
SL1584R-01 50 µL

Rabbit Anti-NDRG1 antibody

Sign In for Pricing
View Details
Rabbit Anti-NDRG1 antibody
SL1584R-02 100 µL

Rabbit Anti-NDRG1 antibody

Sign In for Pricing
View Details
CD86 Protein, Human, Recombinant (ECD, hFc Tag)
PH50860M4-01 100 µg

CD86 Protein, Human, Recombinant (ECD, hFc Tag)

Sign In for Pricing
View Details
CD86 Protein, Human, Recombinant (ECD, hFc Tag)
PH50860M4-02 1 mg

CD86 Protein, Human, Recombinant (ECD, hFc Tag)

Sign In for Pricing
View Details