MYBPC3 Peptide - C-terminal region
MYBPC3 Peptide - C-terminal region
Product Specifications
UniProt
B6D426
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYBPC3 Rabbit Polyclonal Antibody (orb578027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941530-100 1x 100 µL
Calpain 1 (CAPN1/1530), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941588-500 1x 500 µL
CD62L (L-Selectin) (CD62L/1588), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY420394 100 µg
SLC35G2 (NM_001097600) Human Over-expression Lysate
Sign In for Pricing
View Details