MYBPC3 Peptide - C-terminal region
MYBPC3 Peptide - C-terminal region
Product Specifications
UniProt
B6D426
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYBPC3 Rabbit Polyclonal Antibody (orb578027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-OSEL-Ch0005-01 24 Tests
QuicKey Pro Chicken Pg (Progesterone) ELISA Kit
Sign In for Pricing
View Details E-OSEL-Ch0005-02 48 Tests
QuicKey Pro Chicken Pg (Progesterone) ELISA Kit
Sign In for Pricing
View Details E-OSEL-Ch0005-03 96 Tests
QuicKey Pro Chicken Pg (Progesterone) ELISA Kit
Sign In for Pricing
View Details 
LY418137 100 µg
Synaptogyrin 3 (SYNGR3) (NM_004209) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNCB2409-500 1x 500 µL
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-604-40 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Cytomegalovirus, 40nm
Sign In for Pricing
View Details