RADIL Peptide - C-terminal region
RADIL Peptide - C-terminal region
Product Specifications
UniProt
Q96JH8
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RADIL Rabbit Polyclonal Antibody (orb578650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADGRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ROR2 Mouse Monoclonal Antibody [Clone ID: OTI4B10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908971/imageurl/cf810020.webp)
BNC941130-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 