Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARD1 Peptide - C-terminal region

BARD1 Peptide - C-terminal region

Product Specifications

UniProt

F6MDH8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BARD1 Rabbit Polyclonal Antibody (orb578662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAAT1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-05312 0.1 mg

BAAT1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Ccdc65 Mouse shRNA Plasmid (Locus ID 105833)
TR505731 1 Kit

Ccdc65 Mouse shRNA Plasmid (Locus ID 105833)

Sign In for Pricing
View Details
HMGCL Antibody (N-term) [APR07770G]
APR07770G-01 50 µL

HMGCL Antibody (N-term) [APR07770G]

Sign In for Pricing
View Details
HMGCL Antibody (N-term) [APR07770G]
APR07770G-02 100 µL

HMGCL Antibody (N-term) [APR07770G]

Sign In for Pricing
View Details
HMGCL Antibody (N-term) [APR07770G]
APR07770G-03 200 µL

HMGCL Antibody (N-term) [APR07770G]

Sign In for Pricing
View Details
HMGCL Antibody (N-term) [APR07770G]
APR07770G-04 400 µL

HMGCL Antibody (N-term) [APR07770G]

Sign In for Pricing
View Details