Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARD1 Peptide - C-terminal region

BARD1 Peptide - C-terminal region

Product Specifications

UniProt

F6MDH8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BARD1 Rabbit Polyclonal Antibody (orb578662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUK1 (Guanylate Kinase 1, GMK, OTTHUMP00000037504, OTTHUMP00000037740, OTTHUMP00000037741, OTTHUMP00000037742, OTTHUMP00000037748, OTTHUMP00000037750, OTTHUMP00000061419)
207690 200 µL

GUK1 (Guanylate Kinase 1, GMK, OTTHUMP00000037504, OTTHUMP00000037740, OTTHUMP00000037741, OTTHUMP00000037742, OTTHUMP00000037748, OTTHUMP00000037750, OTTHUMP00000061419)

Sign In for Pricing
View Details
FAIM1 Antibody
DF6119-01 100 µL

FAIM1 Antibody

Sign In for Pricing
View Details
FAIM1 Antibody
DF6119-02 200 µL

FAIM1 Antibody

Sign In for Pricing
View Details
PE/Fire™ 640 anti-mouse CD185 (CXCR5)
GT04893 100 µg

PE/Fire™ 640 anti-mouse CD185 (CXCR5)

Sign In for Pricing
View Details
AACS sgRNA CRISPR Lentivector (Human) (Target 1)
K0014502 1.0 µg DNA

AACS sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
DDX56 Blocking Peptide
MBS9633789-01 1 mg

DDX56 Blocking Peptide

Sign In for Pricing
View Details