Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP6 Peptide - N-terminal region

RBBP6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MY038, P2P-R, PACT, RBQ-1, SNAMA

UniProt

Q7Z6E9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBBP6 Rabbit Polyclonal Antibody (orb578709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116015

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR7 (NM_001838) Human Over-expression Lysate
LC419718 20 µg

CCR7 (NM_001838) Human Over-expression Lysate

Sign In for Pricing
View Details
PGF Antibody
KC-716-01 50 μL

PGF Antibody

Sign In for Pricing
View Details
PGF Antibody
KC-716-02 100 µL

PGF Antibody

Sign In for Pricing
View Details
PGF Antibody
KC-716-03 1 mL

PGF Antibody

Sign In for Pricing
View Details
EnzyChrom™ Nitric Oxide Synthase Assay Kit
ENOS-100 100 Tests

EnzyChrom™ Nitric Oxide Synthase Assay Kit

Sign In for Pricing
View Details
Streptavidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW0STF-SA5/200/W 10x 96 Well Plates

Streptavidin Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details