Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZRN3 Peptide - N-terminal region

PDZRN3 Peptide - N-terminal region

Product Specifications

UniProt

Q9UPQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZRN3 Rabbit Polyclonal Antibody (orb325057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphorus(V) Oxybromide
TRC-P360880-25G 25 g

Phosphorus(V) Oxybromide

Sign In for Pricing
View Details
NLRC5 Human Gene Knockout Kit (CRISPR)
KN414810 1 Kit

NLRC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CDK2 (phospho T14) Antibody
RC-5560-01 50 μL

Recombinant CDK2 (phospho T14) Antibody

Sign In for Pricing
View Details
Recombinant CDK2 (phospho T14) Antibody
RC-5560-02 100 µL

Recombinant CDK2 (phospho T14) Antibody

Sign In for Pricing
View Details
Recombinant CDK2 (phospho T14) Antibody
RC-5560-03 1 mL

Recombinant CDK2 (phospho T14) Antibody

Sign In for Pricing
View Details
DACH2 Human Gene Knockout Kit (CRISPR)
KN419595 1 Kit

DACH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details