Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZRN3 Peptide - N-terminal region

PDZRN3 Peptide - N-terminal region

Product Specifications

UniProt

Q9UPQ7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZRN3 Rabbit Polyclonal Antibody (orb325057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAP3 Human Knockdown Lysate
LY300364 100 µg

LAP3 Human Knockdown Lysate

Sign In for Pricing
View Details
LOK (STK10) (C-term) Rabbit Polyclonal Antibody
AP14848PU-N 400 µL

LOK (STK10) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant M6PR Antibody
RC-16202-01 50 μL

Recombinant M6PR Antibody

Sign In for Pricing
View Details
Recombinant M6PR Antibody
RC-16202-02 100 µL

Recombinant M6PR Antibody

Sign In for Pricing
View Details
Recombinant M6PR Antibody
RC-16202-03 1 mL

Recombinant M6PR Antibody

Sign In for Pricing
View Details
FOXF2 Rabbit Polyclonal Antibody
ER1802-3 100 µL

FOXF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details