Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC3 Peptide - middle region

HERC3 Peptide - middle region

Product Specifications

UniProt

F5GWU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HERC3 Rabbit Polyclonal Antibody (orb578764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEETFCLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPI Antibody
orb423478-01 5 µg

GPI Antibody

Sign In for Pricing
View Details
GPI Antibody
orb423478-02 20 µg

GPI Antibody

Sign In for Pricing
View Details
GPI Antibody
orb423478-03 100 µg

GPI Antibody

Sign In for Pricing
View Details
TEX26 siRNA (Mouse)
orb1839740-01 15 nmol

TEX26 siRNA (Mouse)

Sign In for Pricing
View Details
TEX26 siRNA (Mouse)
orb1839740-02 30 nmol

TEX26 siRNA (Mouse)

Sign In for Pricing
View Details
ADAP2 Conjugated Antibody
orb1614365 100 µL

ADAP2 Conjugated Antibody

Sign In for Pricing
View Details