Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49C Peptide - N-terminal region

TRIM49C Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRIM49L2

UniProt

P0CI26

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49C Rabbit Polyclonal Antibody (orb578853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182163

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA3 antibody
70R-19575 50 ul

PSMA3 antibody

Sign In for Pricing
View Details
Bovine Kisspeptin 1 (KISS1) ELISA Kit-Competitive
EK8F462 96 Tests

Bovine Kisspeptin 1 (KISS1) ELISA Kit-Competitive

Sign In for Pricing
View Details
ABCC2 (Canalicular Multispecific Organic Anion Transporter 1, ATP-binding Cassette Sub-family C Member 2, Canalicular Multidrug Resistance Protein, Multidrug Resistance-associated Protein 2, CMOAT, CMOAT1, CMRP, MRP2) (APC)
122805-APC 100 µL

ABCC2 (Canalicular Multispecific Organic Anion Transporter 1, ATP-binding Cassette Sub-family C Member 2, Canalicular Multidrug Resistance Protein, Multidrug Resistance-associated Protein 2, CMOAT, CMOAT1, CMRP, MRP2) (APC)

Sign In for Pricing
View Details
MCL1 (NM_021960) Human Tagged ORF Clone
RC200521 10 µg

MCL1 (NM_021960) Human Tagged ORF Clone

Sign In for Pricing
View Details
Gap junction beta-2 protein (GJB2) Antibody
abx349913-01 50 µL

Gap junction beta-2 protein (GJB2) Antibody

Sign In for Pricing
View Details
Gap junction beta-2 protein (GJB2) Antibody
abx349913-02 100 µL

Gap junction beta-2 protein (GJB2) Antibody

Sign In for Pricing
View Details