Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM49C Peptide - N-terminal region

TRIM49C Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRIM49L2

UniProt

P0CI26

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM49C Rabbit Polyclonal Antibody (orb578853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182163

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)
MBS1753226-01 0.01 mg

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)

Sign In for Pricing
View Details
Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)
MBS1753226-02 0.1 mg (Carrier Free)

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)

Sign In for Pricing
View Details
Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)
MBS1753226-03 0.1 mg

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)

Sign In for Pricing
View Details
Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)
MBS1753226-04 0.1 mg (Cy3)

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)

Sign In for Pricing
View Details
Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)
MBS1753226-05 0.1 mg (Biotin)

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)

Sign In for Pricing
View Details
Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)
MBS1753226-06 0.1 mg (HRP)

Anti-alpha 1 Catenin/CTNNA1 Antibody (Monoclonal, 10I2)

Sign In for Pricing
View Details