ABCA2 Peptide - N-terminal region
ABCA2 Peptide - N-terminal region
Product Specifications
UniProt
E9PGB2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ABCA2 Rabbit Polyclonal Antibody (orb330323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880759-100 1x 100 µL
Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 