Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCA2 Peptide - N-terminal region

ABCA2 Peptide - N-terminal region

Product Specifications

UniProt

E9PGB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABCA2 Rabbit Polyclonal Antibody (orb330323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta COP (COPB1) (NM_001144062) Human Over-expression Lysate
LC428489 20 µg

beta COP (COPB1) (NM_001144062) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIB3 Mouse Monoclonal Antibody [Clone ID: OTI3C6]
CF807483 100 µg

TRIB3 Mouse Monoclonal Antibody [Clone ID: OTI3C6]

Sign In for Pricing
View Details
2-Acetamido-2,6-dideoxy-L-talose
TRC-A158405-1MG 1 mg

2-Acetamido-2,6-dideoxy-L-talose

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS628262 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
Purified Anti-Mouse TCR V beta8.1/2 Antibody[KJ16-133.18]
AN004820P-01 25 µg

Purified Anti-Mouse TCR V beta8.1/2 Antibody[KJ16-133.18]

Sign In for Pricing
View Details
Purified Anti-Mouse TCR V beta8.1/2 Antibody[KJ16-133.18]
AN004820P-02 100 µg

Purified Anti-Mouse TCR V beta8.1/2 Antibody[KJ16-133.18]

Sign In for Pricing
View Details