Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC6A5 Peptide - N-terminal region

SLC6A5 Peptide - N-terminal region

Product Specifications

UniProt

Q4VAM4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC6A5 Rabbit Polyclonal Antibody (orb325098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc31a1 Antibody - N-terminal region
ARP43824_P050-25UL 25 µL

Slc31a1 Antibody - N-terminal region

Sign In for Pricing
View Details
XYLT2 Protein Vector (Rat) (pPB-N-His)
PV316911 500 ng

XYLT2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
MCCC2 (Center) Rabbit pAb
MBS8558830-01 0.1 mL

MCCC2 (Center) Rabbit pAb

Sign In for Pricing
View Details
MCCC2 (Center) Rabbit pAb
MBS8558830-02 0.1 mL (AF405L)

MCCC2 (Center) Rabbit pAb

Sign In for Pricing
View Details
MCCC2 (Center) Rabbit pAb
MBS8558830-03 0.1 mL (AF405S)

MCCC2 (Center) Rabbit pAb

Sign In for Pricing
View Details
MCCC2 (Center) Rabbit pAb
MBS8558830-04 0.1 mL (AF610)

MCCC2 (Center) Rabbit pAb

Sign In for Pricing
View Details