Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A14 Peptide - N-terminal region

SLC22A14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OCTL2, OCTL4, ORCTL4

UniProt

Q9Y267

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A14 Rabbit Polyclonal Antibody (orb578977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004794

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crtac1 Mouse Gene Knockout Kit (CRISPR)
KN503848 1 Kit

Crtac1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caspase 3 (CASP3) Mouse Monoclonal Antibody [Clone ID: OTI7B8]
CF813276 100 µg

Caspase 3 (CASP3) Mouse Monoclonal Antibody [Clone ID: OTI7B8]

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF640R conjugate, 0.1mg/mL
BNC402245-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OR51J1 activation kit by CRISPRa
GA112450 1 Kit

Human OR51J1 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene AM NH₂
H40002.5G 5 g

Polystyrene AM NH₂

Sign In for Pricing
View Details
OR11A1 Human Gene Knockout Kit (CRISPR)
KN423230 1 Kit

OR11A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details