SGCB Peptide - middle region
SGCB Peptide - middle region
Product Specifications
UniProt
Q6IBJ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SGCB Rabbit Polyclonal Antibody (orb579103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Monoclonal Carbonic Anhydrase VB/CA5B Antibody (030) [PE]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-90091PE 0.1 mL
Rabbit Monoclonal Carbonic Anhydrase VB/CA5B Antibody (030) [PE]
Sign In for Pricing
View Details 
B2021132 100 µg
Rabbit Monoclonal AK2 Antibody (Human, Mouse, Rat) Lyophilized
Sign In for Pricing
View Details 
044377-APC 200 µL
ZNF813, NT (ZNF813, Zinc finger protein 813) (APC) discontinued
Sign In for Pricing
View Details