Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPPL2B Peptide - N-terminal region

SPPL2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMP-4, IMP4, PSH4, PSL1

UniProt

Q8TCT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPPL2B Rabbit Polyclonal Antibody (orb325199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694533

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES5A Protein Vector (Mouse) (pPM-C-His)
PV164941 500 ng

CES5A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
KIR2DL1/CD158a, Recombinant, Human, His-Tag discontinued
591192-01 20 µg

KIR2DL1/CD158a, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
KIR2DL1/CD158a, Recombinant, Human, His-Tag discontinued
591192-02 100 µg

KIR2DL1/CD158a, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
EEF1G CRISPRa sgRNA lentivector (set of three targets)(Mouse)
18985124 3x 1.0µg DNA

EEF1G CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Bovine intestinal fatty acid binding protein(iFABP) ELISA Kit
MBS2609312-01 48 Well

Bovine intestinal fatty acid binding protein(iFABP) ELISA Kit

Sign In for Pricing
View Details
Bovine intestinal fatty acid binding protein(iFABP) ELISA Kit
MBS2609312-02 96 Well

Bovine intestinal fatty acid binding protein(iFABP) ELISA Kit

Sign In for Pricing
View Details