Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPPL2B Peptide - N-terminal region

SPPL2B Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMP-4, IMP4, PSH4, PSL1

UniProt

Q8TCT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPPL2B Rabbit Polyclonal Antibody (orb325199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694533

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane P24 Trafficking Protein 3 (TMED3) Antibody
abx145015-01 100 µg

Transmembrane P24 Trafficking Protein 3 (TMED3) Antibody

Sign In for Pricing
View Details
Transmembrane P24 Trafficking Protein 3 (TMED3) Antibody
abx145015-02 1 mg

Transmembrane P24 Trafficking Protein 3 (TMED3) Antibody

Sign In for Pricing
View Details
Recombinant Variola virus Major envelope protein (C17L, F13L)
MBS1134425-01 0.02 mg (Baculovirus)

Recombinant Variola virus Major envelope protein (C17L, F13L)

Sign In for Pricing
View Details
Recombinant Variola virus Major envelope protein (C17L, F13L)
MBS1134425-02 0.1 mg (Baculovirus)

Recombinant Variola virus Major envelope protein (C17L, F13L)

Sign In for Pricing
View Details
Recombinant Variola virus Major envelope protein (C17L, F13L)
MBS1134425-03 1 mg (Baculovirus)

Recombinant Variola virus Major envelope protein (C17L, F13L)

Sign In for Pricing
View Details
Recombinant Variola virus Major envelope protein (C17L, F13L)
MBS1134425-04 5x 1 mg (Baculovirus)

Recombinant Variola virus Major envelope protein (C17L, F13L)

Sign In for Pricing
View Details