Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBEGF Peptide - N-terminal region

HBEGF Peptide - N-terminal region

Product Specifications

Product Name Alternative

DTR, DTS, DTSF, HEGFL

UniProt

Q99075

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HBEGF Rabbit Polyclonal Antibody (orb579406) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001936

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-500 1x 500 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details