UNC5C Peptide - C-terminal region
UNC5C Peptide - C-terminal region
Product Specifications
UniProt
O95185
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UNC5C Rabbit Polyclonal Antibody (orb330417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MTRF1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]](https://cdn.genprice.uk/products/937/68dd1b66061270361ea144d4/imageurl/ta501067bm.webp)
TA501067BM 100 µL
MTRF1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]
Sign In for Pricing
View Details 
