Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5C Peptide - C-terminal region

UNC5C Peptide - C-terminal region

Product Specifications

UniProt

O95185

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UNC5C Rabbit Polyclonal Antibody (orb330417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Bis(m-tolyloxy)ethane
TRC-M333348-5G 5 g

1,2-Bis(m-tolyloxy)ethane

Sign In for Pricing
View Details
BATF (N-term) Rabbit Polyclonal Antibody
AP50345PU-N 400 µL

BATF (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Apbb2 activation kit by CRISPRa
GA200223 1 Kit

Mouse Apbb2 activation kit by CRISPRa

Sign In for Pricing
View Details
Multi Angle Spectrophotometer BMAS-1201
BMAS-1201 1 Unit

Multi Angle Spectrophotometer BMAS-1201

Sign In for Pricing
View Details
Angiotensin (1-7) xTFA salt
TRC-A637945-50MG 50 mg

Angiotensin (1-7) xTFA salt

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details