Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E1 Peptide - C-terminal region

NR2E1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TLL, TLX, XTLL

UniProt

Q9Y466

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR2E1 Rabbit Polyclonal Antibody (orb579508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003260

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAPTA Rabbit Polyclonal Antibody
AP05075PU-N 100 µg

BAPTA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EYA1 (NM_000503) Human Over-expression Lysate
LC424681 20 µg

EYA1 (NM_000503) Human Over-expression Lysate

Sign In for Pricing
View Details
S100 beta Recombinant Chimeric Antibody Antibody
HA610367 100 µL

S100 beta Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Aurothioglucose 80%
TRC-A794790-50MG 50 mg

Aurothioglucose 80%

Sign In for Pricing
View Details
DDX3Y Antibody
8C14653-AAT 50 µg

DDX3Y Antibody

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit
RD-C1qA-Hu-01 96 Tests

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit

Sign In for Pricing
View Details