Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2B Peptide - middle region

RRM2B Peptide - middle region

Product Specifications

UniProt

Q7LG56

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRM2B Rabbit Polyclonal Antibody (orb579630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB40B Antibody, FITC conjugated
CSB-PA615534LC01HU-01 50 µg

RAB40B Antibody, FITC conjugated

Sign In for Pricing
View Details
RAB40B Antibody, FITC conjugated
CSB-PA615534LC01HU-02 100 µg

RAB40B Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti-TMEM173 Antibody Picoband® (Cy3 Conjugate)
PB9513-Cy3 100 µg/Vial

Anti-TMEM173 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
Napepld (NM_199381) Rat Untagged Clone
RN209281 10 µg

Napepld (NM_199381) Rat Untagged Clone

Sign In for Pricing
View Details
USP22 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-63012R-BF750-01 20 µL

USP22 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
USP22 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-63012R-BF750-02 100 µL

USP22 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details