Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2B Peptide - middle region

RRM2B Peptide - middle region

Product Specifications

UniProt

Q7LG56

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRM2B Rabbit Polyclonal Antibody (orb579630) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Galanin receptor type 1 (Galr1)
MBS7015451-01 0.02 mg

Recombinant Mouse Galanin receptor type 1 (Galr1)

Sign In for Pricing
View Details
Recombinant Mouse Galanin receptor type 1 (Galr1)
MBS7015451-02 0.1 mg

Recombinant Mouse Galanin receptor type 1 (Galr1)

Sign In for Pricing
View Details
Recombinant Mouse Galanin receptor type 1 (Galr1)
MBS7015451-03 5x 0.1 mg

Recombinant Mouse Galanin receptor type 1 (Galr1)

Sign In for Pricing
View Details
NRSF Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61633R-PE-Cy5.5 100 µL

NRSF Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
MFI2 Rabbit pAb
E45R26722N-100 100 µL

MFI2 Rabbit pAb

Sign In for Pricing
View Details
Tle6 Mouse shRNA Lentiviral Particle (Locus ID 114606)
TL512104V 500 µL Each

Tle6 Mouse shRNA Lentiviral Particle (Locus ID 114606)

Sign In for Pricing
View Details