Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL10 Peptide - N-terminal region

MRPL10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L10MT, MRP-L10, MRP-L8, MRPL8, RPML8

UniProt

Q7Z7H8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL10 Rabbit Polyclonal Antibody (orb579707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683685

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLPGSSDSPASASQVAGITGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMYD3 Recombinant Rabbit Monoclonal Antibody [JM73-63]
ET1705-58 100 µL

SMYD3 Recombinant Rabbit Monoclonal Antibody [JM73-63]

Sign In for Pricing
View Details
OR4D11 Adenovirus (Human)
35197051 1.0 mL

OR4D11 Adenovirus (Human)

Sign In for Pricing
View Details
TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, TGN38 Homolog, TGN46, TGN48, Trans-Golgi Network Protein TGN51, TGN51, TTGN2) (PE)
134398-PE 100 µL

TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, TGN38 Homolog, TGN46, TGN48, Trans-Golgi Network Protein TGN51, TGN51, TTGN2) (PE)

Sign In for Pricing
View Details
HNMT 3'UTR GFP Stable Cell Line
TU060023 1.0 mL

HNMT 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GDF-8 Antibody
251651 0.1 mg

GDF-8 Antibody

Sign In for Pricing
View Details
FITC-linked Antibody to Glutamine synthetase (GS)
MBS2014862-01 0.1 mL

FITC-linked Antibody to Glutamine synthetase (GS)

Sign In for Pricing
View Details