Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL10 Peptide - N-terminal region

MRPL10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L10MT, MRP-L10, MRP-L8, MRPL8, RPML8

UniProt

Q7Z7H8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL10 Rabbit Polyclonal Antibody (orb579707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683685

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLPGSSDSPASASQVAGITGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Highly Sensitive 8-OHdG Check ELISA
KOG-HS10E 96 Well

Highly Sensitive 8-OHdG Check ELISA

Sign In for Pricing
View Details
Angiomotin (AMOT) (NM_001113490) Human Tagged ORF Clone
RG226319 10 µg

Angiomotin (AMOT) (NM_001113490) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human CCDC141 Knockout HEK293T cell line
GTR15413471 1 Vial

Human CCDC141 Knockout HEK293T cell line

Sign In for Pricing
View Details
Phospho-NFKB (S536) Antibody [APR07151G]
APR07151G-01 50 µL

Phospho-NFKB (S536) Antibody [APR07151G]

Sign In for Pricing
View Details
Phospho-NFKB (S536) Antibody [APR07151G]
APR07151G-02 100 µL

Phospho-NFKB (S536) Antibody [APR07151G]

Sign In for Pricing
View Details
Phospho-NFKB (S536) Antibody [APR07151G]
APR07151G-03 200 µL

Phospho-NFKB (S536) Antibody [APR07151G]

Sign In for Pricing
View Details