Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEFF2 Peptide - C-terminal region

TMEFF2 Peptide - C-terminal region

Product Specifications

UniProt

Q9UIK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEFF2 Rabbit Polyclonal Antibody (orb579993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR2DL4 Rabbit pAb
E45R19447N-100 100 µL

KIR2DL4 Rabbit pAb

Sign In for Pricing
View Details
Wdr45l ORF Vector (Rat) (pORF)
50335016 1.0 µg DNA

Wdr45l ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Influenza B virus Hemagglutinin (HA), partial
MBS1092090 Inquire

Recombinant Influenza B virus Hemagglutinin (HA), partial

Sign In for Pricing
View Details
Human CD63 Mouse mAb, BF555 conjugated
orb2978935 100 µL

Human CD63 Mouse mAb, BF555 conjugated

Sign In for Pricing
View Details
PTPN23 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38159126 3x 1.0µg DNA

PTPN23 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
20mL ScrewNeck Vial Amber Glass
CHR2600 1000 / PCK

20mL ScrewNeck Vial Amber Glass

Sign In for Pricing
View Details