Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEFF2 Peptide - C-terminal region

TMEFF2 Peptide - C-terminal region

Product Specifications

UniProt

Q9UIK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEFF2 Rabbit Polyclonal Antibody (orb579993) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Caspase 5 ELISA Kit
MBS078664-01 48 Well

Porcine Caspase 5 ELISA Kit

Sign In for Pricing
View Details
Porcine Caspase 5 ELISA Kit
MBS078664-02 96 Well

Porcine Caspase 5 ELISA Kit

Sign In for Pricing
View Details
Porcine Caspase 5 ELISA Kit
MBS078664-03 5x 96 Well

Porcine Caspase 5 ELISA Kit

Sign In for Pricing
View Details
Porcine Caspase 5 ELISA Kit
MBS078664-04 10x 96 Well

Porcine Caspase 5 ELISA Kit

Sign In for Pricing
View Details
1- (Benzenesulfonyl) -4-chloro-5-nitro-1H-pyrrolo[2,3-b]pyridine
OR93859-01 1 g

1- (Benzenesulfonyl) -4-chloro-5-nitro-1H-pyrrolo[2,3-b]pyridine

Sign In for Pricing
View Details
1- (Benzenesulfonyl) -4-chloro-5-nitro-1H-pyrrolo[2,3-b]pyridine
OR93859-02 5 g

1- (Benzenesulfonyl) -4-chloro-5-nitro-1H-pyrrolo[2,3-b]pyridine

Sign In for Pricing
View Details