Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBDL2 Peptide - N-terminal region

RHBDL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RRP2

UniProt

B3KUN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHBDL2 Rabbit Polyclonal Antibody (orb325335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060291

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYTH3 antibody
FNab02192 100 µg

CYTH3 antibody

Sign In for Pricing
View Details
Lentiviral human PRPSAP1 shRNA (UAS) - Lentiviral human PRPSAP1 shRNA (UAS, GFP) (100)
GTR15328104 1 Vial

Lentiviral human PRPSAP1 shRNA (UAS) - Lentiviral human PRPSAP1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse mmu-miR-7094-1-5p miRNA Antagomir
abx889495-01 10 nmol

Mouse mmu-miR-7094-1-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-7094-1-5p miRNA Antagomir
abx889495-02 20 nmol

Mouse mmu-miR-7094-1-5p miRNA Antagomir

Sign In for Pricing
View Details
IN-1130
MBS5769214 Inquire

IN-1130

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) (FITC)
H1909-09L-FITC 100 µL

Hepatitis B Surface Antigen (HBsAg) (FITC)

Sign In for Pricing
View Details