Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTAP Peptide - N-terminal region

MTAP Peptide - N-terminal region

Product Specifications

UniProt

Q13126

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTAP Rabbit Polyclonal Antibody (orb580454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Floor Standing Shaking Incubator BSFT-1802
BSFT-1802 1 Unit

Floor Standing Shaking Incubator BSFT-1802

Sign In for Pricing
View Details
Human CCDC11 (CFAP53) activation kit by CRISPRa
GA116565 1 Kit

Human CCDC11 (CFAP53) activation kit by CRISPRa

Sign In for Pricing
View Details
Human MAGEH1 activation kit by CRISPRa
GA109191 1 Kit

Human MAGEH1 activation kit by CRISPRa

Sign In for Pricing
View Details
C1d (NM_020558) Mouse Tagged ORF Clone
MG200907 10 µg

C1d (NM_020558) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse GFOD2 Protein (His Tag)
PKSM040326 100 µg

Recombinant Mouse GFOD2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PPA1 protein (His tag)
PDEH101009-01 20 µg

Recombinant Human PPA1 protein (His tag)

Sign In for Pricing
View Details