Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT9 Peptide - C-terminal region

GALNT9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GALNAC-T9

UniProt

J3KNN1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT9 Rabbit Polyclonal Antibody (orb580556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116108

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

26S Proteasome p54 (28) FITC
sc-65748 FITC 200 µg/mL

26S Proteasome p54 (28) FITC

Sign In for Pricing
View Details
Frozen Tissue Sections, Pericardium
CS814855 5x 5 µm

Frozen Tissue Sections, Pericardium

Sign In for Pricing
View Details
MGAT5 (NM_002410) Human Tagged Lenti ORF Clone
RC213548L2 10 µg

MGAT5 (NM_002410) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sprr2k CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
45395154 3x 1.0 µg DNA

Sprr2k CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YIHY Polyclonal Antibody
MBS7162927 Inquire

Rabbit anti-Escherichia coli (strain K12) YIHY Polyclonal Antibody

Sign In for Pricing
View Details
Human Syntaxin 2 ELISA Kit
IHUSTX2KT 1 Each

Human Syntaxin 2 ELISA Kit

Sign In for Pricing
View Details