Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT9 Peptide - C-terminal region

GALNT9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GALNAC-T9

UniProt

J3KNN1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT9 Rabbit Polyclonal Antibody (orb580556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116108

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apeh ORF Vector (Mouse) (pORF)
12139014 1.0 µg DNA

Apeh ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SLCO1B3 Antibody
orb1249434 0.1 mg

SLCO1B3 Antibody

Sign In for Pricing
View Details
Human CXCR4 Alexa Fluor 488 Antibody (Clone 12G5R)
FAB1701G-100UG 100 µg

Human CXCR4 Alexa Fluor 488 Antibody (Clone 12G5R)

Sign In for Pricing
View Details
Lentiviral mouse Limk1 shRNA (UAS) - Lentiviral mouse Limk1 shRNA (UAS, GFP) plasmid
GTR15190102 1 Vial

Lentiviral mouse Limk1 shRNA (UAS) - Lentiviral mouse Limk1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SOSTDC1 Protein, Rat, Recombinant (His & Myc)
TMPH-03367-01 5 µg

SOSTDC1 Protein, Rat, Recombinant (His & Myc)

Sign In for Pricing
View Details
SOSTDC1 Protein, Rat, Recombinant (His & Myc)
TMPH-03367-02 10 µg

SOSTDC1 Protein, Rat, Recombinant (His & Myc)

Sign In for Pricing
View Details