Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHDDS Peptide - C-terminal region

DHDDS Peptide - C-terminal region

Product Specifications

UniProt

Q86SQ9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHDDS Rabbit Polyclonal Antibody (orb325429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Piperazin-1-yl-thieno[2,3-c] pyridine (hydrochloride)
HY-W327038 1 Each

7-Piperazin-1-yl-thieno[2,3-c] pyridine (hydrochloride)

Sign In for Pricing
View Details
HSPB1 Antibody
orb570481-01 50 µg

HSPB1 Antibody

Sign In for Pricing
View Details
HSPB1 Antibody
orb570481-02 100 µg

HSPB1 Antibody

Sign In for Pricing
View Details
Methyl 4H,5H,6H,7H-pyrazolo[1,5-a]pyrazine-3-carboxylate hydrochloride
MKD76858-01 50 mg

Methyl 4H,5H,6H,7H-pyrazolo[1,5-a]pyrazine-3-carboxylate hydrochloride

Sign In for Pricing
View Details
Methyl 4H,5H,6H,7H-pyrazolo[1,5-a]pyrazine-3-carboxylate hydrochloride
MKD76858-02 0.5 g

Methyl 4H,5H,6H,7H-pyrazolo[1,5-a]pyrazine-3-carboxylate hydrochloride

Sign In for Pricing
View Details
CDK4 Antibody FITC Conjugated
MBS9459957-01 0.1 mL

CDK4 Antibody FITC Conjugated

Sign In for Pricing
View Details