DHDDS Peptide - C-terminal region
DHDDS Peptide - C-terminal region
Product Specifications
UniProt
Q86SQ9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DHDDS Rabbit Polyclonal Antibody (orb325429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-BC-K171-S-01 50 Assays (36 samples)
Total Carbonyl Colorimetric Assay Kit
Sign In for Pricing
View Details E-BC-K171-S-02 100 Assays (86 samples)
Total Carbonyl Colorimetric Assay Kit
Sign In for Pricing
View Details 
BNUB1881-100 1x 100 µL
Prohibitin (Mitochondrial Marker) (PHB/1881), 0.2mg/mL
Sign In for Pricing
View Details ![Peroxiredoxin 6 Recombinant Mouse Monoclonal Antibody [7G1-R]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82b62/imageurl/ha601301.webp)
HA601301 100 µL
Peroxiredoxin 6 Recombinant Mouse Monoclonal Antibody [7G1-R]
Sign In for Pricing
View Details ![PIN4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H2]](https://cdn.genprice.uk/products/937/6868c3f3994c49e6dc401fc0/imageurl/ta808412bm.webp)
TA808412BM 100 µL
PIN4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H2]
Sign In for Pricing
View Details 