PCDHB14 Peptide - middle region
PCDHB14 Peptide - middle region
Product Specifications
UniProt
B4DPE2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCDHB14 Rabbit Polyclonal Antibody (orb580716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YGKISYTFFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP319368 20 µg
NMDAR1 (GRIN1) (NM_000832) Human Recombinant Protein
Sign In for Pricing
View Details 
GF-PL-200 200 Preparations
GF-1 Plasmid DNA Extraction Kit (RNase A included), 200 preps
Sign In for Pricing
View Details 