MANEAL Peptide - middle region
MANEAL Peptide - middle region
Product Specifications
Product Name Alternative
RP11-109P14.3
UniProt
Q5VSG8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MANEAL Rabbit Polyclonal Antibody (orb325516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689709
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041906-100 1x 100 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP762663 50 µg
Heparanase 1 (HPSE) (NM_001098540) Human Recombinant Protein
Sign In for Pricing
View Details 
RD-CCK8-Ra-01 96 Tests
Rat Cholecystokinin 8, Octapeptide (CCK8) ELISA Kit
Sign In for Pricing
View Details