Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MANEAL Peptide - middle region

MANEAL Peptide - middle region

Product Specifications

Product Name Alternative

RP11-109P14.3

UniProt

Q5VSG8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MANEAL Rabbit Polyclonal Antibody (orb325516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689709

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP30 Human Gene Knockout Kit (CRISPR)
KN402538 1 Kit

USP30 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DHRS4 (NM_001282989) Human Tagged ORF Clone
RG236451 10 µg

DHRS4 (NM_001282989) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rpl7l1 Mouse Gene Knockout Kit (CRISPR)
KN515057 1 Kit

Rpl7l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-609
BMET-609 1 Unit

Multi-parameter Analyzer BMET-609

Sign In for Pricing
View Details
Trametinib (DMSO Solvate)
TRC-T314310-1G 1 g

Trametinib (DMSO Solvate)

Sign In for Pricing
View Details
Human YIF1B activation kit by CRISPRa
GA114029 1 Kit

Human YIF1B activation kit by CRISPRa

Sign In for Pricing
View Details