Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UXS1 Peptide - N-terminal region

UXS1 Peptide - N-terminal region

Product Specifications

UniProt

B3KV61

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UXS1 Rabbit Polyclonal Antibody (orb580917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl22l1 (NM_026517) Mouse Tagged ORF Clone
MG200606 10 µg

Rpl22l1 (NM_026517) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL
BNC473092-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp74 Mouse Gene Knockout Kit (CRISPR)
KN519960 1 Kit

Zfp74 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Acetyl-Histone H3 Antibody Sampler Kit
HAK21081 1 Kit

Acetyl-Histone H3 Antibody Sampler Kit

Sign In for Pricing
View Details
NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F5]
TA502330AM 100 µL

NUDT6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F5]

Sign In for Pricing
View Details
SSBP1 Antibody
KC-17049-01 50 μL

SSBP1 Antibody

Sign In for Pricing
View Details